ONECUT2 / HNF6B antibody

Antigen: ONECUT2 / HNF6B

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN504378

Additional Information

Gene ID: ONECUT2

UniProt: O95948

Immunogen: The immunogen for anti-ONECUT2 antibody: synthetic peptide directed towards the middle region of human ONECUT2

Sequence: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFT DLQRRTLFAI

Cross-Reactivity: Human, Mouse (Murine)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ONECUT2 antibody concentration is 1 mg/ml.

Description: ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT

Characteristics: Antigen Size: 504 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-ONECUT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ONECUT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysate

Publications

Product: Chamberlain, Qian, Stiles et al.: "Integration of inositol phosphate signaling pathways via human ITPK1." in: The Journal of biological chemistry, Vol. 282, Issue 38, pp. 28117-25, 2007 (PubMed).