Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Tripartite Motif Containing 31 (TRIM31) antibody

Antigen

Tripartite Motif Containing 31 (TRIM31)

Synonyms RNF, HCG1, HCGI, C6orf13, BC026666, MGC37625, TRIM31
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504384
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name TRIM31
Gene ID TRIM31
UniProt Q9BZY9
Immunogen The immunogen for anti-TRIM31 antibody: synthetic peptide directed towards the middle region of human TRIM31
Sequence HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDV ALSEELHAAL
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-TRIM31 antibody concentration is 1 mg/ml.
Description TRIM31 encodes for a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus.
Characteristics Antigen Size: 425 amino acids
Molecular Weight 48kDa

Application Details

Application Notes WB Suggested Anti-TRIM31 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer
Restrictions For Research Use only

Publications

Product Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives

Alternatives for antigen "Tripartite Motif Containing 31 (TRIM31)", type "Antibodies"
Hosts Rabbit (29)
Reactivities Human (28), Mouse (Murine) (2), Cow (Bovine) (1), Rat (Rattus) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (13), ELISA (11), Immunohistochemistry (IHC) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (2), C-Term (1), N-Term (1)