Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 174 (ZNF174) antibody

Antigen

Zinc Finger Protein 174 (ZNF174)
Synonyms Znf174, ZNF174, MGC127259
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Dog (Canine)
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504418
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Zinc Finger Protein 174 (ZNF174) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name ZNF174
Gene ID ZNF174
UniProt Q15697
Immunogen The immunogen for anti-ZNF174 antibody: synthetic peptide directed towards the middle region of human ZNF174
Sequence DNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMS EPRLSRRQVS
Cross-Reactivity Cow (Bovine), Dog (Canine), Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF174 antibody concentration is 1 mg/ml.
Description Zinc finger protein 174.
Characteristics Antigen Size: 407 amino acids
Molecular Weight 46kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-ZNF174 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Zinc Finger Protein 174 (ZNF174)", type "Antibodies"
Hosts Rabbit (12), Mouse (4)
Reactivities Human (16), Mouse (Murine) (2), Rat (Rattus) (2), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (14), ELISA (9), Immunohistochemistry (IHC) (6), Immunofluorescence (IF) (5), Dot Blot (Dot) (1), Immunoprecipitation (IP) (1)
Epitopes Internal Region (2), Center (1), N-Term (1)