Coiled-Coil Domain Containing 74A (CCDC74A) antibody

Antigen: Coiled-Coil Domain Containing 74A (CCDC74A)

Synonyms: 2310015A05Rik, FLJ40345, CCDC74AV2, CCDC74AV3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN504468

Additional Information

Alternative name: CCDC74A

Gene ID: CCDC74A

UniProt: Q96AQ1

Immunogen: The immunogen for anti-CCDC74A antibody: synthetic peptide directed towards the middle region of human CCDC74A

Sequence: FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQK RLQAMQKRRL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CCDC74A antibody concentration is 1 mg/ml.

Description: The exact function of CCDC74A remains unknown.

Characteristics: Antigen Size: 378 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-CCDC74A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CCDC74A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).