FK506 Binding Protein 2, 13kDa (FKBP2) antibody

Antigen: FK506 Binding Protein 2, 13kDa (FKBP2)

Synonyms: PPIase, FKBP-13, 13kDa, FKBP-2, mFKBP2, mFKBP13, Fkbp12, Bmfkbp13

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN504473

Additional Information

Alternative name: FKBP2 / FKBP13

Gene ID: FKBP2

UniProt: P26885

Immunogen: The immunogen for anti-FKBP2 antibody: synthetic peptide directed towards the N terminal of human FKBP2

Sequence: RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDH CPIKSRKGDV

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-FKBP2 antibody concentration is 1 mg/ml.

Description: FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. This gene has two alternatively spliced transcript variants that encode the same isoform. Multiple polyadenylation sites have been described for this gene, but the full length nature of this gene has not been determined.

Characteristics: Antigen Size: 142 amino acids

Molecular Weight: 16kDa

Application Details

Application Notes: WB Suggested Anti-FKBP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-FKBP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Publications

Product: Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).