Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Penta-EF-Hand Domain Containing 1 (PEF1) antibody

Antigen

Penta-EF-Hand Domain Containing 1 (PEF1)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504483
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Peflin / PEF1
Gene ID PEF1
UniProt Q9UBV8
Immunogen The immunogen for anti-PEF1 antibody: synthetic peptide directed towards the middle region of human PEF1
Sequence WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSP QFTQLLVSRY
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PEF1 antibody concentration is 1 mg/ml.
Description PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1, MIM 114170), sorcin (SRI, MIM 182520), grancalcin (GCA, MIM 607030), and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit (CAPNS1, MIM 114170), sorcin (SRI, MIM 182520), grancalcin (GCA, MIM 607030), and ALG2 (PDCD6, MIM 601057) (Kitaura et al., 2001 [PubMed 11278427]).[supplied by OMIM]. Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1640 AB026628.1 1-1640
Characteristics Antigen Size: 284 amino acids
Molecular Weight 31kDa

Application Details

Application Notes WB Suggested Anti-PEF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Jordanova, Irobi, Thomas et al.: "Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy." in: Nature genetics, Vol. 38, Issue 2, pp. 197-202, 2006 (PubMed).

Alternatives

Alternatives for antigen "Penta-EF-Hand Domain Containing 1 (PEF1)", type "Antibodies"
Hosts Rabbit (24)
Reactivities Human (23), Mouse (Murine) (21), Rat (Rattus) (21), Cow (Bovine) (18), Cat (Feline) (1), Chicken (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (9), ELISA (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (IHC) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (1)