Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Keratin 75 (KRT75) antibody

Antigen

Keratin 75 (KRT75)

Synonyms PFB, K6HF, KB18, K6hf, Krtcap1, AA589387, Krt2-6hf, 4732468K03Rik, Kb18, KRT75, MGC151863, KRT5, KRT6A
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504534
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Cytokeratin 75
Gene ID KRT75
UniProt O95678
Immunogen The immunogen for anti-KRT75 antibody: synthetic peptide directed towards the N terminal of human KRT75
Sequence MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARS AAGSGGLGRI
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-KRT75 antibody concentration is 1 mg/ml.
Description This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion
Characteristics Antigen Size: 551 amino acids
Molecular Weight 59kDa

Application Details

Application Notes WB Suggested Anti-KRT75 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Schweizer, Bowden, Coulombe et al.: "New consensus nomenclature for mammalian keratins." in: The Journal of cell biology, Vol. 174, Issue 2, pp. 169-74, 2006 (PubMed).