Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Programmed Cell Death 7 (PDCD7) antibody

Antigen

Programmed Cell Death 7 (PDCD7)
Synonyms ES18, HES18, MGC22015
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504538
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Programmed Cell Death 7 (PDCD7) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name PDCD7
Gene ID PDCD7
UniProt Q8N8D1
Immunogen The immunogen for anti-PDCD7 antibody: synthetic peptide directed towards the middle region of human PDCD7
Sequence YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLP PLPSNDIWAT
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PDCD7 antibody concentration is 1 mg/ml.
Description PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramid
Characteristics Antigen Size: 485 amino acids
Molecular Weight 55kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-PDCD7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: NCI-H226 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Programmed Cell Death 7 (PDCD7)", type "Antibodies"
Hosts Rabbit (29), Mouse (4)
Reactivities Human (27), Mouse (Murine) (26), Rat (Rattus) (23), Cow (Bovine) (2), Cat (Feline) (1), Chicken (1), Dog (Canine) (1)
Applications Western Blotting (WB) (18), Immunofluorescence (IF) (15), ELISA (9), Immunohistochemistry (IHC) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Flow Cytometry (FACS) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (1), Internal Region (1), N-Term (1)