T-Cell Leukemia/lymphoma 1A (TCL1A) antibody

Antigen: T-Cell Leukemia/lymphoma 1A (TCL1A)

Synonyms: TCL1, TCL1A, Tcl1, Tcl1a

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN504546

Additional Information

Alternative name: TCL1A / TCL1

Gene ID: TCL1A

UniProt: P56279

Immunogen: The immunogen for anti-TCL1A antibody: synthetic peptide directed towards the N terminal of human TCL1A

Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIE IKDRLQLRVL

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TCL1A antibody concentration is 1 mg/ml.

Description: TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3,promote nuclear translocation of AKT1,enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.

Characteristics: Antigen Size: 114 amino acids

Molecular Weight: 13kDa

Application Details

Application Notes: WB Suggested Anti-TCL1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-TCL1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain

Publications

Product: Herling, Patel, Teitell et al.: "High TCL1 expression and intact T-cell receptor signaling define a hyperproliferative subset of T-cell prolymphocytic leukemia." in: Blood, Vol. 111, Issue 1, pp. 328-37, 2007 (PubMed).