Eukaryotic Translation Initiation Factor 2C3 (EIF2C3) antibody

Antigen: Eukaryotic Translation Initiation Factor 2C3 (EIF2C3)

Synonyms: AGO3, FLJ12765, MGC86946, Ago3, AW048688, C130014L07Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken, Dog (Canine), Pig (Porcine), Fruit Fly (Drosophila melanogaster)

Application: Western Blotting (WB)

Catalog no.: ABIN504548

Additional Information

Alternative name: EIF2C3 / AGO3

Gene ID: EIF2C3

UniProt: B1ALI0

Immunogen: The immunogen for anti-EIF2C3 antibody: synthetic peptide directed towards the N terminal of human EIF2C3

Sequence: MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCG TMRRKYRVCN

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-EIF2C3 antibody concentration is 1 mg/ml.

Description: EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is

Characteristics: Antigen Size: 626 amino acids

Molecular Weight: 69kDa

Application Details

Application Notes: WB Suggested Anti-EIF2C3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-EIF2C3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus

Publications

Product: Sasaki, Shiohama, Minoshima et al.: "Identification of eight members of the Argonaute family in the human genome small star, filled." in: Genomics, Vol. 82, Issue 3, pp. 323-30, 2003 (PubMed).