Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504589

Cyclin-Dependent Kinase 18 (CDK18) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Ctk18, Pctk3, AA682070, PCTAIRE, PCTAIRE3, PCTK3, DKFZp468H0312, pctk1, pctaire, MGC89093, pctaire3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504589
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PCTK3 antibody: synthetic peptide directed towards the N terminal of human PCTK3
Sequence IMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRR NENLQLGPLG
Predicted Reactivity Bovine :100%,   Chicken :100%,   Green puffer :100%,   Sumatran orangutan :100%,   Human :100%,   Rat :92%,   Mouse :92%,   Western clawed frog :91%,  
Characteristics This is a rabbit polyclonal antibody against PCTK3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PCTK3
Background PCTK3 belongs to the protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily. PCTK3 contains 1 protein kinase domain. It may play a role in signal transduction cascades in terminally differentiated cells.
Molecular Weight 57kDa
Gene ID 5129
NCBI Accession NP_997668, NM_212503
UniProt Q07002-3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PCTK3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wissing, Jänsch, Nimtz et al.: "Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 3, pp. 537-47, 2007 (PubMed).

Alternatives for antigen "Cyclin-Dependent Kinase 18 (CDK18)", type "Antibodies"
Hosts (19), (2)
Reactivities (16), (9), (2)
Applications (20), (6), (3), (2), (2), (1)
Epitopes (7), (5), (2), (2), (2), (2), (2), (1)
Beacon