Ets Variant 6 (ETV6) antibody

Antigen: Ets Variant 6 (ETV6)

Synonyms: TEL, TEL/ABL, Tel, AW123102, AW557856, tel, id:ibd2308, MGC124677, ETV6, MGC143391, tel/abl, MGC146892

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish, Dog (Canine), Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN504653

Additional Information

Alternative name: ETV6 / TEL1

Gene ID: ETV6

UniProt: P41212

Immunogen: The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the N terminal of human ETV6

Sequence: WAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGD VLYELLQHIL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ETV6 antibody concentration is 1 mg/ml.

Description: ETV6 (ETS-related protein Tel1, ETS translocation variant 6 , Tel) is an ETS family transcription factor. it contains two functional domains: a N-terminal pointed (PNT) domain that is involved in the protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma.This gene encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N-terminal pointed (PNT) domain that is involved in the protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 452 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-ETV6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ETV6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate

Publications

Product: Rubnitz, Wichlan, Devidas et al.: "Prospective analysis of TEL gene rearrangements in childhood acute lymphoblastic leukemia: a Children's Oncology Group study." in: Journal of clinical oncology : official journal of the American Society of Clinical Oncology, Vol. 26, Issue 13, pp. 2186-91, 2008 (PubMed).