Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504653

Ets Variant 6 (ETV6) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TEL, TEL/ABL, Tel, AW123102, AW557856, tel, id:ibd2308, etv-6, tel/abl
Reactivity
»Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken, Zebrafish, Dog (Canine), Xenopus laevis
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504653
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the N terminal of human ETV6
Sequence WAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGD VLYELLQHIL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 92%, Guinea pig : 92%
Characteristics Antigen Size: 452 amino acids
Purification Affinity Purified
Alternative Name ETV6 / TEL1
Background ETV6 (ETS-related protein Tel1, ETS translocation variant 6 , Tel) is an ETS family transcription factor. it contains two functional domains: a N-terminal pointed (PNT) domain that is involved in the protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma.This gene encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N-terminal pointed (PNT) domain that is involved in the protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma.
Molecular Weight 53kDa
Gene ID ETV6
UniProt P41212
Application Notes WB Suggested Anti-ETV6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-ETV6 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Rubnitz, Wichlan, Devidas et al.: "Prospective analysis of TEL gene rearrangements in childhood acute lymphoblastic leukemia: a Children's Oncology Group study." in: Journal of clinical oncology : official journal of the American Society of Clinical Oncology, Vol. 26, Issue 13, pp. 2186-91, 2008 (PubMed).

Alternatives for antigen "Ets Variant 6 (ETV6)", type "Antibodies"
Hosts (44), (4)
Reactivities (46), (28), (13), (13), (13), (12), (1), (1), (1)
Applications (39), (22), (10), (8), (8), (8), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (4), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon