Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504671

Cold Shock Domain Protein A (CSDA) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CSDA, CSDA1, DBPA, ZONAB, Csda, Dpba, MSY3, MSY4, Yb2, dbpA, oxyR, Dbpa, contrin, csda, csda-A, csda3, dbpc, frgy2, msy2, p54
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504671
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA
Sequence RYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGY RRPYNYRRRP
Cross-Reactivity Human
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Guinea pig : 91%, Mouse : 91%, Rat : 91%
Characteristics Antigen Size: 372 amino acids
Purification Affinity Purified
Alternative Name DNA-binding protein A
Background Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
Molecular Weight 40kDa
Gene ID CSDA
UniProt P16989
Application Notes WB Suggested Anti-CSDA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-CSDA antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Cold Shock Domain Protein A (CSDA)", type "Antibodies"
Hosts (33), (7)
Reactivities (37), (18), (14), (14), (14), (12), (2), (1), (1), (1), (1), (1), (1)
Applications (31), (15), (10), (5), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (3), (2), (2), (1), (1), (1), (1)
Beacon