FAH antibody

Catalog No. ABIN629635

This Rabbit Polyclonal antibody specifically detects FAH in WB and IHC. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FAH antibody (ABIN629635)

Target: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAH antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-FAH Antibody

Purification: Purified

Immunogen: FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAH Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FAH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAH

Target: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Alternative Name: FAH

Background: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.

Molecular Weight: 46 kDa (MW of target protein)