PDHA1 antibody

Catalog No. ABIN629667

The Rabbit Polyclonal anti-PDHA1 antibody (ABIN629667) specifically detects PDHA1 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for PDHA1 antibody (ABIN629667)

Target: PDHA1 (Pyruvate Dehydrogenase (Lipoamide) alpha 1 (PDHA1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDHA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDHA1 Antibody

Purification: Purified

Immunogen: PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDHA1 Blocking Peptide, (ABIN5615283), is also available for use as a blocking control in assays to test for specificity of this PDHA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDHA1

Target: PDHA1 (Pyruvate Dehydrogenase (Lipoamide) alpha 1 (PDHA1))

Alternative Name: PDHA1

Background: The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1), dihydrolipoyl transacetylase (DLAT), and dihydrolipoyl dehydrogenase (DLD).

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Warburg Effect