AKAP7 antibody

Catalog No. ABIN629711

The Rabbit Polyclonal anti-AKAP7 antibody is suitable to detect AKAP7 in samples from Human. It has been validated for WB.

Quick Overview for AKAP7 antibody (ABIN629711)

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKAP7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AKAP7 Antibody

Purification: Purified

Immunogen: AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LELKPFIEELLQGKHLTLPFQGIGTFGNQVGFVKLAEGDHVNSLLEIAET

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKAP7 Blocking Peptide, (ABIN940300), is also available for use as a blocking control in assays to test for specificity of this AKAP7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKAP7

Target: AKAP7 (A Kinase (PRKA) Anchor Protein 7 (AKAP7))

Alternative Name: AKAP7

Background: AKAP7 encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations.

Molecular Weight: 36 kDa (MW of target protein)