Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

LIM Domain Binding 3 (LDB3) antibody

Antigen

LIM Domain Binding 3 (LDB3)

Synonyms ZASP, CYPHER, ORACLE, PDLIM6, ldb3z1, ldb3z4, FLJ35865, KIAA0613, KIAA01613, AW742271, MGC118603, ldb3l, zgc:55814, wu:fi31d08, ldb3, MGC52706, MGC75668, LDB3, RGD1564875
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN629714
Quantity 100 ug  (1 mg/ml)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name LDB3
Immunogen LDB3 antibody was raised using the N terminal of LDB3 corresponding to a region with amino acids PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS
Description LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.
Molecular Weight 36 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LDB3 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling
Restrictions For Research Use only

Alternatives

Alternatives for antigen "LIM Domain Binding 3 (LDB3)", type "Antibodies"
Hosts Mouse (6), Goat (4), Rabbit (1)
Reactivities Human (9), Dog (Canine) (2), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (10), Enzyme Immunoassay (EIA) (4), ELISA (3), Immunofluorescence (IF) (2), ELISA (Detection) (1)