UBE2D1 antibody
| Antigen |
|
| Clonality |
Polyclonal |
|
Host
|
|
|
Application
|
|
| Catalog no. |
ABIN629731 |
| Quantity |
100 ug (1 mg/ml) |
| Price |
410.33 $ Plus shipping costs $35.00
|
| Shipping to |
|
| Availability |
Ships within 5 to 7 Business Days |
|
Immunogen
|
UBE2D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE
|
|
Description
|
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2D1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases.
|
|
Molecular Weight
|
16 kDa (MW of target protein)
|
|
Concentration
|
1 mg/ml
|
|
Purification
|
Total IgG Protein A purified
|
|
Buffer
|
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UBE2D1 antibody in PBS
|
|
Storage
|
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
|
|
Restrictions
|
For Research Use only
|
Alternatives for antigen "UBE2D1", type "Antibodies"