TCAP antibody

Catalog No. ABIN629822

The Rabbit Polyclonal anti-TCAP antibody is suitable to detect TCAP in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for TCAP antibody (ABIN629822)

Target: TCAP (Titin-Cap (Telethonin) (TCAP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCAP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TCAP Antibody

Purification: Purified

Immunogen: TCAP antibody was raised using a synthetic peptide corresponding to a region with amino acids IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCAP Blocking Peptide, (ABIN939503), is also available for use as a blocking control in assays to test for specificity of this TCAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCAP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCAP

Target: TCAP (Titin-Cap (Telethonin) (TCAP))

Alternative Name: TCAP

Background: Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.

Molecular Weight: 19 kDa (MW of target protein)