ZBP1 antibody (Middle Region)

Catalog No. ABIN629830

This Rabbit Polyclonal antibody specifically detects ZBP1 in WB. It exhibits reactivity toward Human.

Quick Overview for ZBP1 antibody (Middle Region) (ABIN629830)

Target: ZBP1 (Z-DNA Binding Protein 1 (ZBP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZBP1 Antibody

Binding Specificity: Middle Region

Specificity: ZBP1 antibody was raised against the middle region of ZBP1

Purification: Purified

Immunogen: ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZBP1

Target: ZBP1 (Z-DNA Binding Protein 1 (ZBP1))

Alternative Name: ZBP1

Background: ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.

Molecular Weight: 47 kDa (MW of target protein)