Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ZBP1 antibody

Antigen

ZBP1

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN629830
Quantity 100 ug  (1 mg/ml)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG
Description ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.
Molecular Weight 47 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ZBP1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "ZBP1", type "Antibodies"
Hosts Mouse (2), Rabbit (2)
Reactivities Human (4)
Applications Western Blotting (WB) (4), ELISA (1), Enzyme Immunoassay (EIA) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)