ACP1 antibody (N-Term)

Catalog No. ABIN629849

The Rabbit Polyclonal anti-ACP1 antibody is suitable to detect ACP1 in samples from Human. It has been validated for WB and IHC.

Quick Overview for ACP1 antibody (N-Term) (ABIN629849)

Target: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ACP1 Antibody

Binding Specificity: N-Term

Specificity: ACP1 antibody was raised against the N terminal of ACP1

Purification: Purified

Immunogen: ACP1 antibody was raised using the N terminal of ACP1 corresponding to a region with amino acids PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACP1 Blocking Peptide, (ABIN5611911), is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACP1

Target: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Alternative Name: ACP1

Background: ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate.

Molecular Weight: 17 kDa (MW of target protein)