Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2) antibody

Antigen

Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2)

Synonyms MGC119575, MGC119576, MGC119577, A630055H10Rik, CPEB2, cpeb2, DKFZp469M211
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN629930
Quantity 100 ug  (1 mg/ml)  (Variants)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name CPEB2
Immunogen CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL
Description CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.
Molecular Weight 37 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CPEB2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2)", type "Antibodies"
Hosts Rabbit (5)
Reactivities Human (3)
Applications Western Blotting (WB) (5)