HFM1 antibody

Catalog No. ABIN629932

This Rabbit Polyclonal antibody specifically detects HFM1 in WB. It exhibits reactivity toward Human.

Quick Overview for HFM1 antibody (ABIN629932)

Target: HFM1 (HFM1, ATP-Dependent DNA Helicase Homolog (HFM1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HFM1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HFM1 Antibody

Purification: Purified

Immunogen: Helicase antibody was raised using a synthetic peptide corresponding to a region with amino acids FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Helicase Blocking Peptide, (ABIN938299), is also available for use as a blocking control in assays to test for specificity of this Helicase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HELB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HFM1

Target: HFM1 (HFM1, ATP-Dependent DNA Helicase Homolog (HFM1))

Alternative Name: Helicase

Background: The protein encoded by this gene is a DNA helicase. A dominant-negative mutant of this protein blocks chromosomal DNA replication and suggests that its function is required for S phase entry.

Molecular Weight: 120 kDa (MW of target protein)