HNRNPA0 antibody (Middle Region)

Catalog No. ABIN629936

The Rabbit Polyclonal anti-HNRNPA0 antibody is suitable to detect HNRNPA0 in samples from Human. It has been validated for WB and IHC.

Quick Overview for HNRNPA0 antibody (Middle Region) (ABIN629936)

Target: HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPA0 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-HNRNPA0 Antibody

Binding Specificity: Middle Region

Specificity: HNRPA0 antibody was raised against the middle region of HNRPA0

Purification: Purified

Immunogen: HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG

Application Details

Application Notes: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HNRPA0 Blocking Peptide, (ABIN939620), is also available for use as a blocking control in assays to test for specificity of this HNRPA0 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPA0

Target: HNRNPA0 (Heterogeneous Nuclear Ribonucleoprotein A0 (HNRNPA0))

Alternative Name: HNRPA0

Background: HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

Molecular Weight: 34 kDa (MW of target protein)