MATR3 antibody (C-Term)

Catalog No. ABIN629963

The Rabbit Polyclonal anti-MATR3 antibody is suitable to detect MATR3 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for MATR3 antibody (C-Term) (ABIN629963)

Target: MATR3 (Matrin 3 (MATR3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MATR3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MATR3 Antibody

Binding Specificity: C-Term

Specificity: Matrin 3 antibody was raised against the C terminal of MATR3

Purification: Purified

Immunogen: Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Matrin 3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MATR3

Target: MATR3 (Matrin 3 (MATR3))

Alternative Name: Matrin 3

Background: MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.

Molecular Weight: 94 kDa (MW of target protein)