Seryl-tRNA Synthetase (SARS) (Middle Region) antibody

Catalog No. ABIN630018

The Rabbit Polyclonal anti-Seryl-tRNA Synthetase antibody (ABIN630018) specifically detects Seryl-tRNA Synthetase in WB. The antibody is reactive with Human, Mouse and Dog samples.

Quick Overview for Seryl-tRNA Synthetase (SARS) (Middle Region) antibody (ABIN630018)

Target: Seryl-tRNA Synthetase (SARS)

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: SARS antibody was raised against the middle region of SARS

Purification: Purified

Immunogen: SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SARS Blocking Peptide, (ABIN5615999), is also available for use as a blocking control in assays to test for specificity of this SARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Seryl-tRNA Synthetase (SARS)

Alternative Name: SARS

Background: SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Molecular Weight: 57 kDa (MW of target protein)