Poly(rC) Binding Protein 2 (PCBP2) antibody

Antigen: Poly(rC) Binding Protein 2 (PCBP2)

Synonyms: HNRPE2, hnRNP-E2, MGC110998, Hnrpx, AW412548, MGC107004, alphaCP-2, PCBP3, fb36h02, MGC55964, zgc:55964, wu:fb36h02, pcbp2, MGC79904, PCBP2, MGC69512, MGC127996

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN630038

Additional Information

Alternative name: PCBP2

Immunogen: PCBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE

Description: PCBP2 appears to be multifunctional. It along with PCBP-1 and hnRNPK corresponds to the major cellular poly(rC)-binding proteins. This protein together with PCBP-1 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability.

Molecular Weight: 39 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Total IgG Protein A purified

Buffer: Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PCBP2 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Restrictions: For Research Use only