PCMT1 antibody

Catalog No. ABIN630131

The Rabbit Polyclonal anti-PCMT1 antibody is suitable to detect PCMT1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for PCMT1 antibody (ABIN630131)

Target: PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCMT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCMT1 Antibody

Purification: Purified

Immunogen: PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCMT1 Blocking Peptide, (ABIN936828), is also available for use as a blocking control in assays to test for specificity of this PCMT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCMT1

Target: PCMT1 (Protein-L-Isoaspartate (D-Aspartate) O-Methyltransferase (PCMT1))

Alternative Name: PCMT1

Background: Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization