IL18RAP antibody (N-Term)

Catalog No. ABIN630238

This Rabbit Polyclonal antibody specifically detects IL18RAP in WB. It exhibits reactivity toward Human.

Quick Overview for IL18RAP antibody (N-Term) (ABIN630238)

Target: IL18RAP (Interleukin 18 Receptor Accessory Protein (IL18RAP))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL18RAP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IL18RAP Antibody

Binding Specificity: N-Term

Specificity: IL18 RAP antibody was raised against the N terminal of IL18 AP

Purification: Purified

Immunogen: IL18 RAP antibody was raised using the N terminal of IL18 AP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL18RAP Blocking Peptide, (ABIN5614172), is also available for use as a blocking control in assays to test for specificity of this IL18RAP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 AP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL18RAP

Target: IL18RAP (Interleukin 18 Receptor Accessory Protein (IL18RAP))

Alternative Name: IL18RAP

Background: IL18RAP is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.

Molecular Weight: 66 kDa (MW of target protein)