SLC10A5 antibody

Catalog No. ABIN630340

This Rabbit Polyclonal antibody specifically detects SLC10A5 in IHC and WB. It exhibits reactivity toward Human.

Quick Overview for SLC10A5 antibody (ABIN630340)

Target: SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC10A5 antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details anti-SLC10A5 Antibody

Purification: Purified

Immunogen: SLC10 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC10A5 Blocking Peptide, (ABIN939070), is also available for use as a blocking control in assays to test for specificity of this SLC10A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC10A5

Target: SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))

Alternative Name: SLC10A5

Background: SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.

Molecular Weight: 48 kDa (MW of target protein)