Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

HBS1-Like (S. Cerevisiae) (HBS1L) antibody

Antigen

HBS1-Like (S. Cerevisiae) (HBS1L)

Synonyms ERFS, HBS1, EF-1a, HSPC276, DKFZp686L13262, eRFS, AI326327, 2810035F15Rik, zgc:55400, wu:fc23c07, MGC137542, DKFZp459A1713
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630516
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name HBS1L
Immunogen HBS1L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH
Description HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.
Molecular Weight 22 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HBS1L antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Stem Cells, Hematopoietic Progenitors
Restrictions For Research Use only

Alternatives

Alternatives for antigen "HBS1-Like (S. Cerevisiae) (HBS1L)", type "Antibodies"
Hosts Rabbit (2), Mouse (1)
Reactivities Human (3)
Applications Western Blotting (WB) (3), ELISA (Detection) (2), ELISA (1)