SAMSN1 antibody (Middle Region)

Catalog No. ABIN630534

The Rabbit Polyclonal anti-SAMSN1 antibody (ABIN630534) specifically detects SAMSN1 in WB. The antibody is reactive with Human samples.

Quick Overview for SAMSN1 antibody (Middle Region) (ABIN630534)

Target: SAMSN1 (SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAMSN1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SAMSN1 Antibody

Binding Specificity: Middle Region

Specificity: SAMSN1 antibody was raised against the middle region of SAMSN1

Purification: Affinity purified

Immunogen: SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAMSN1 Blocking Peptide, (ABIN937393), is also available for use as a blocking control in assays to test for specificity of this SAMSN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMSN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAMSN1

Target: SAMSN1 (SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1))

Alternative Name: SAMSN1

Background: SAMSN1 is a member of a novel protein family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.

Molecular Weight: 42 kDa (MW of target protein)