TPI1 antibody (N-Term)

Catalog No. ABIN630577

This Rabbit Polyclonal antibody specifically detects TPI1 in WB. It exhibits reactivity toward Human.

Quick Overview for TPI1 antibody (N-Term) (ABIN630577)

Target: TPI1 (Triosephosphate Isomerase 1 (TPI1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPI1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TPI1 Antibody

Binding Specificity: N-Term

Specificity: TPI1 antibody was raised against the N terminal of TPI1

Purification: Affinity purified

Immunogen: TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPI1 Blocking Peptide, (ABIN5616740), is also available for use as a blocking control in assays to test for specificity of this TPI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPI1

Target: TPI1 (Triosephosphate Isomerase 1 (TPI1))

Alternative Name: TPI1

Background: TPI1 belongs to the triosephosphate isomerase family. Defects in TPI1 are the cause of triosephosphate isomerase deficiency (TPI deficiency) . TPI deficiency is an autosomal recessive disorder. It is the most severe clinical disorder of glycolysis. It is associated with neonatal jaundice, chronic hemolytic anemia, progressive neuromuscular dysfunction, cardiomyopathy and increased susceptibility to infection.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis