PIP5KL1 antibody (Middle Region)

Catalog No. ABIN630616

This Rabbit Polyclonal antibody specifically detects PIP5KL1 in WB. It exhibits reactivity toward Human.

Quick Overview for PIP5KL1 antibody (Middle Region) (ABIN630616)

Target: PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIP5KL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIP5KL1 Antibody

Binding Specificity: Middle Region

Specificity: PIP5 KL1 antibody was raised against the middle region of PIP5 L1

Purification: Affinity purified

Immunogen: PIP5 KL1 antibody was raised using the middle region of PIP5 L1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIP5KL1 Blocking Peptide, (ABIN5615385), is also available for use as a blocking control in assays to test for specificity of this PIP5KL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 L1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIP5KL1

Target: PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))

Alternative Name: PIP5KL1

Background: PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Inositol Metabolic Process