CAD antibody (N-Term)

Catalog No. ABIN630621

The Rabbit Polyclonal anti-CAD antibody (ABIN630621) specifically detects CAD in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for CAD antibody (N-Term) (ABIN630621)

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CAD Antibody

Binding Specificity: N-Term

Specificity: CAD antibody was raised against the N terminal of CAD

Purification: Affinity purified

Immunogen: CAD antibody was raised using the N terminal of CAD corresponding to a region with amino acids AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAD Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CAD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAD

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Alternative Name: CAD

Background: CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.

Molecular Weight: 243 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process