PDE7B antibody (Middle Region)

Catalog No. ABIN630666

The Rabbit Polyclonal anti-PDE7B antibody (ABIN630666) specifically detects PDE7B in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for PDE7B antibody (Middle Region) (ABIN630666)

Target: PDE7B (phosphodiesterase 7B (PDE7B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE7B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDE7B Antibody

Binding Specificity: Middle Region

Specificity: PDE7 B antibody was raised against the middle region of PDE7

Purification: Affinity purified

Immunogen: PDE7 B antibody was raised using the middle region of PDE7 corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDE7B Blocking Peptide, (ABIN939359), is also available for use as a blocking control in assays to test for specificity of this PDE7B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDE7B

Target: PDE7B (phosphodiesterase 7B (PDE7B))

Alternative Name: PDE7B

Background: The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: cAMP Metabolic Process