PIN4 antibody (Middle Region)

Catalog No. ABIN630680

The Rabbit Polyclonal anti-PIN4 antibody is suitable to detect PIN4 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for PIN4 antibody (Middle Region) (ABIN630680)

Target: PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIN4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIN4 Antibody

Binding Specificity: Middle Region

Specificity: PIN4 antibody was raised against the middle region of PIN4

Purification: Affinity purified

Immunogen: PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIN4 Blocking Peptide, (ABIN940388), is also available for use as a blocking control in assays to test for specificity of this PIN4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIN4

Target: PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))

Alternative Name: PIN4

Background: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle and chromatin remodeling.

Molecular Weight: 16 kDa (MW of target protein)