F-Box and Leucine-Rich Repeat Protein 3 (FBXL3) antibody

Antigen: F-Box and Leucine-Rich Repeat Protein 3 (FBXL3)

Synonyms: FBL3, FBL3A, FBXL3A, FBK, Ovtm, Fbl3a, Fbxl3a, AU041772, AW212966, fbxl3, MGC80572, FBXL3, MGC151742, F7A7.240, F7A7_240

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN630702

Additional Information

Alternative name: FBXL3

Immunogen: FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV

Description: FBXL3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.

Molecular Weight: 47 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXL3 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Proteolysis / Ubiquitin

Restrictions: For Research Use only