CEP55 antibody (N-Term)

Catalog No. ABIN630721

This Rabbit Polyclonal antibody specifically detects CEP55 in WB. It exhibits reactivity toward Human.

Quick Overview for CEP55 antibody (N-Term) (ABIN630721)

Target: CEP55 (Centrosomal Protein 55kDa (CEP55))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CEP55 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CEP55 Antibody

Binding Specificity: N-Term

Specificity: CEP55 antibody was raised against the N terminal of CEP55

Purification: Affinity purified

Immunogen: CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CEP55 Blocking Peptide, (ABIN5612824), is also available for use as a blocking control in assays to test for specificity of this CEP55 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEP55 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CEP55

Target: CEP55 (Centrosomal Protein 55kDa (CEP55))

Alternative Name: CEP55

Background: CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.

Molecular Weight: 54 kDa (MW of target protein)