PHLDA1 antibody (Middle Region)

Catalog No. ABIN630749

The Rabbit Polyclonal anti-PHLDA1 antibody is suitable to detect PHLDA1 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for PHLDA1 antibody (Middle Region) (ABIN630749)

Target: PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHLDA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PHLDA1 Antibody

Binding Specificity: Middle Region

Specificity: PHLDA1 antibody was raised against the middle region of PHLDA1

Purification: Affinity purified

Immunogen: PHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHLDA1 Blocking Peptide, (ABIN5615350), is also available for use as a blocking control in assays to test for specificity of this PHLDA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHLDA1

Target: PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))

Alternative Name: PHLDA1

Background: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.

Molecular Weight: 45 kDa (MW of target protein)