BLVRB antibody (Middle Region)

Catalog No. ABIN630752

The Rabbit Polyclonal anti-BLVRB antibody is suitable to detect BLVRB in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for BLVRB antibody (Middle Region) (ABIN630752)

Target: BLVRB (Flavin Reductase (BLVRB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BLVRB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BLVRB Antibody

Binding Specificity: Middle Region

Specificity: BLVRB antibody was raised against the middle region of BLVRB

Purification: Affinity purified

Immunogen: BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BLVRB Blocking Peptide, (ABIN938789), is also available for use as a blocking control in assays to test for specificity of this BLVRB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLVRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BLVRB

Target: BLVRB (Flavin Reductase (BLVRB))

Alternative Name: BLVRB

Background: BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.

Molecular Weight: 22 kDa (MW of target protein)