ABAT antibody (Middle Region)

Catalog No. ABIN630787

This Rabbit Polyclonal antibody specifically detects ABAT in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ABAT antibody (Middle Region) (ABIN630787)

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABAT antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABAT Antibody

Binding Specificity: Middle Region

Specificity: ABAT antibody was raised against the middle region of ABAT

Purification: Affinity purified

Immunogen: ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABAT Blocking Peptide, (ABIN939395), is also available for use as a blocking control in assays to test for specificity of this ABAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABAT

Target: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Alternative Name: ABAT

Background: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50 kDa subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde

Molecular Weight: 55 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process