Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

G-Protein Signaling Modulator 2 (GPSM2) antibody

Antigen

G-Protein Signaling Modulator 2 (GPSM2)

Synonyms LGN, Pins, 6230410J09Rik, gpsm2, MGC52811
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630807
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name GPSM2
Immunogen GPSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA
Description Heterotrimeric G proteins transduce extracellular signals received by cell surface receptors into integrated cellular responses. GPSM2 belongs to a group of proteins that modulate activation of G proteins.
Molecular Weight 76 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPSM2 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling
Restrictions For Research Use only

Alternatives

Alternatives for antigen "G-Protein Signaling Modulator 2 (GPSM2)", type "Antibodies"
Hosts Goat (5)
Reactivities Dog (Canine) (3), Human (3)
Applications Western Blotting (WB) (4), Enzyme Immunoassay (EIA) (2), ELISA (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)