MEMO1 antibody (Middle Region)

Catalog No. ABIN630881

The Rabbit Polyclonal anti-MEMO1 antibody is suitable to detect MEMO1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for MEMO1 antibody (Middle Region) (ABIN630881)

Target: MEMO1 (Mediator of Cell Motility 1 (MEMO1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MEMO1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MEMO1 Antibody

Binding Specificity: Middle Region

Specificity: MEMO1 antibody was raised against the middle region of MEMO1

Purification: Affinity purified

Immunogen: MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MEMO1 Blocking Peptide, (ABIN936772), is also available for use as a blocking control in assays to test for specificity of this MEMO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MEMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MEMO1

Target: MEMO1 (Mediator of Cell Motility 1 (MEMO1))

Alternative Name: MEMO1

Background: MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.

Molecular Weight: 34 kDa (MW of target protein)