PDE12 antibody (Middle Region)

Catalog No. ABIN630935

The Rabbit Polyclonal anti-PDE12 antibody is suitable to detect PDE12 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for PDE12 antibody (Middle Region) (ABIN630935)

Target: PDE12 (Phosphodiesterase 12 (PDE12))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDE12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDE12 Antibody

Binding Specificity: Middle Region

Specificity: 2'-PDE antibody was raised against the middle region of 2'-Pde

Purification: Affinity purified

Immunogen: 2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

2'-PDE Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this 2'-PDE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 2'-PDE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDE12

Target: PDE12 (Phosphodiesterase 12 (PDE12))

Alternative Name: 2'-PDE

Background: 2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.

Molecular Weight: 67 kDa (MW of target protein)