Lamin B2 (LMNB2) antibody

Antigen: Lamin B2 (LMNB2)

Synonyms: LMN2, LAMB2, MGC2721, lamin, RGD1563803, lmnb2-a, LMNB2, lmn2, lamb2, Lamin-L(II), LOC100136040

Clonality: Polyclonal

Host: Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN631003

Additional Information

Alternative name: Lamin B2

Immunogen: Lamin B2 antibody was raised using the middle region of LMNB2 corresponding to a region with amino acids EVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM

Description: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.

Molecular Weight: 68 kDa (MW of target protein)

Application Details

Concentration: 1 mg/ml

Purification: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LMNB2 antibody in PBS

Storage: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Research Area: Signaling, Cytoskeleton, Apoptosis/Necrosis

Restrictions: For Research Use only