AIFM3 antibody (Middle Region)

Catalog No. ABIN631043

The Rabbit Polyclonal anti-AIFM3 antibody is suitable to detect AIFM3 in samples from Human. It has been validated for WB.

Quick Overview for AIFM3 antibody (Middle Region) (ABIN631043)

Target: AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AIFM3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AIFM3 Antibody

Binding Specificity: Middle Region

Specificity: AIFM3 antibody was raised against the middle region of AIFM3

Purification: Affinity purified

Immunogen: AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AIFM3 Blocking Peptide, (ABIN937815), is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AIFM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AIFM3

Target: AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))

Alternative Name: AIFM3

Background: AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis