DBNL antibody (Middle Region)

Catalog No. ABIN631047

The Rabbit Polyclonal anti-DBNL antibody (ABIN631047) specifically detects DBNL in WB. The antibody is reactive with Human samples.

Quick Overview for DBNL antibody (Middle Region) (ABIN631047)

Target: DBNL (Drebrin-Like (DBNL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DBNL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DBNL Antibody

Binding Specificity: Middle Region

Specificity: DBNL antibody was raised against the middle region of DBNL

Purification: Affinity purified

Immunogen: DBNL antibody was raised using the middle region of DBNL corresponding to a region with amino acids QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DBNL Blocking Peptide, (ABIN5613128), is also available for use as a blocking control in assays to test for specificity of this DBNL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBNL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DBNL

Target: DBNL (Drebrin-Like (DBNL))

Alternative Name: DBNL

Background: DBNL is an actin-binding adapter protein. DBNL may act as a common effector of antigen receptor-signaling pathways in leukocytes. Its association with dynamin suggests that it may also connect the actin cytoskeleton to endocytic function.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: TCR Signaling, Regulation of Actin Filament Polymerization