TMLHE antibody (Middle Region)

Catalog No. ABIN631052

The Rabbit Polyclonal anti-TMLHE antibody is suitable to detect TMLHE in samples from Human. It has been validated for WB.

Quick Overview for TMLHE antibody (Middle Region) (ABIN631052)

Target: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMLHE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMLHE Antibody

Binding Specificity: Middle Region

Specificity: TMLHE antibody was raised against the middle region of TMLHE

Purification: Affinity purified

Immunogen: TMLHE antibody was raised using the middle region of TMLHE corresponding to a region with amino acids PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMLHE Blocking Peptide, (ABIN5616693), is also available for use as a blocking control in assays to test for specificity of this TMLHE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMLHE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMLHE

Target: TMLHE (Trimethyllysine Hydroxylase, epsilon (TMLHE))

Alternative Name: TMLHE

Background: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane.

Molecular Weight: 49 kDa (MW of target protein)