NDUFC1 antibody

Catalog No. ABIN631080

The Rabbit Polyclonal anti-NDUFC1 antibody (ABIN631080) specifically detects NDUFC1 in WB. The antibody is reactive with Human samples.

Quick Overview for NDUFC1 antibody (ABIN631080)

Target: NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDUFC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NDUFC1 Antibody

Purification: Affinity purified

Immunogen: NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDUFC1 Blocking Peptide, (ABIN5614943), is also available for use as a blocking control in assays to test for specificity of this NDUFC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDUFC1

Target: NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))

Alternative Name: NDUFC1

Background: NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain.

Molecular Weight: 9 kDa (MW of target protein)